Recombinant Human CTCFL
Cat.No. : | CTCFL-27664TH |
Product Overview : | Recombinant fragment corresponding to amino acids 193-293 of Human BORIS with a proprietary tag at N-terminal; Predicted MWt 36.74 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 101 amino acids |
Description : | CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and the protein encoded by this gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. |
Molecular Weight : | 36.740kDa inclusive of tags |
Tissue specificity : | Testis specific. Specifically expressed in primary spermatocytes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKT |
Sequence Similarities : | Belongs to the CTCF zinc-finger protein family.Contains 11 C2H2-type zinc fingers. |
Gene Name | CTCFL CCCTC-binding factor (zinc finger protein)-like [ Homo sapiens ] |
Official Symbol | CTCFL |
Synonyms | CTCFL; CCCTC-binding factor (zinc finger protein)-like; transcriptional repressor CTCFL; BORIS; cancer/testis antigen 27; CT27; dJ579F20.2; |
Gene ID | 140690 |
mRNA Refseq | NM_080618 |
Protein Refseq | NP_542185 |
MIM | 607022 |
Uniprot ID | Q8NI51 |
Chromosome Location | 20q13.31 |
Function | DNA binding; histone binding; metal ion binding; protein binding; sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
CTCFL-1372M | Recombinant Mouse CTCFL Protein (1-636 aa), His-tagged | +Inquiry |
CTCFL-4014M | Recombinant Mouse CTCFL Protein | +Inquiry |
CTCFL-2058H | Recombinant Human CTCFL Protein, GST-tagged | +Inquiry |
CTCFL-434M | Recombinant Mouse CTCFL Protein (1-636 aa), His-SUMO-tagged | +Inquiry |
CTCFL-27664TH | Recombinant Human CTCFL | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTCFL-7212HCL | Recombinant Human CTCFL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTCFL Products
Required fields are marked with *
My Review for All CTCFL Products
Required fields are marked with *
0
Inquiry Basket