Recombinant Human CTGF, Fc-tagged
Cat.No. : | CTGF-2606H |
Product Overview : | Recombinant Human CTGF is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln27-Ala349 ) of Human CTGF fused with a FC tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 27-349 a.a. |
Description : | The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis. |
Form : | Lyophilized from a 0.2 μM filtered solution of PBS,pH 7.4 |
AA Sequence : | QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRK IGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL PGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRV TNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGV CTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMAVD DIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | CTGF connective tissue growth factor [ Homo sapiens ] |
Official Symbol | CTGF |
Synonyms | CTGF; connective tissue growth factor; IGFBP8, CCN2; NOV2; HCS24; MGC102839; hypertrophic chondrocyte-specific protein 24; insulin-like growth factor-binding protein 8; OTTHUMP00000017213; Hypertrophic chondrocyte-specific protein 24 |
Gene ID | 1490 |
mRNA Refseq | NM_001901 |
Protein Refseq | NP_001892 |
MIM | 121009 |
UniProt ID | P29279 |
Chromosome Location | 6q23.1 |
Pathway | Fatty acid, triacylglycerol, and ketone body metabolism; Hippo signaling pathway; PPARA activates gene expression |
Function | growth factor activity; heparin binding; insulin-like growth factor binding; integrin binding; protein binding |
◆ Recombinant Proteins | ||
CTGF-393M | Recombinant Mouse CTGF protein, His-tagged | +Inquiry |
CTGF-4022M | Recombinant Mouse CTGF Protein | +Inquiry |
CTGF-29H | Recombinant Human CTGF, 182-250aa, His-tagged | +Inquiry |
CTGF-1654R | Recombinant Rat CTGF Protein | +Inquiry |
CTGF-28023TH | Recombinant Human CTGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTGF-7205HCL | Recombinant Human CTGF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTGF Products
Required fields are marked with *
My Review for All CTGF Products
Required fields are marked with *