Recombinant Human CTGF protein, GST-tagged
| Cat.No. : | CTGF-301121H |
| Product Overview : | Recombinant Human CTGF protein(80-156 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 80-156 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | LFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CTGF connective tissue growth factor [ Homo sapiens ] |
| Official Symbol | CTGF |
| Synonyms | CTGF; connective tissue growth factor; CCN2; IGFBP8; IBP-8; IGFBP-8; CCN family member 2; IGF-binding protein 8; hypertrophic chondrocyte-specific protein 24; insulin-like growth factor-binding protein 8; NOV2; HCS24; MGC102839; |
| Gene ID | 1490 |
| mRNA Refseq | NM_001901 |
| Protein Refseq | NP_001892 |
| MIM | 121009 |
| UniProt ID | P29279 |
| ◆ Recombinant Proteins | ||
| CTGF-4046H | Recombinant Human CTGF Protein (Met1-Ala349), C-Fc tagged | +Inquiry |
| CTGF-16H | Recombinant Human CTGF, His-tagged | +Inquiry |
| Ctgf-544R | Active Recombinant Rat CTGF protein, His-GST-tagged | +Inquiry |
| CTGF-1287H | Active Recombinant Human CTGF protein, His-GST-tagged | +Inquiry |
| CTGF-30H | Recombinant Human Connective Tissue Growth Factor, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTGF-7205HCL | Recombinant Human CTGF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTGF Products
Required fields are marked with *
My Review for All CTGF Products
Required fields are marked with *
