Recombinant Human CTHRC1 protein, His&Myc-tagged
Cat.No. : | CTHRC1-5710H |
Product Overview : | Recombinant Human CTHRC1 protein(31-243aa)(Q96CG8), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 31-243aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CTHRC1 collagen triple helix repeat containing 1 [ Homo sapiens ] |
Official Symbol | CTHRC1 |
Synonyms | CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1; |
Gene ID | 115908 |
mRNA Refseq | NM_001256099 |
Protein Refseq | NP_001243028 |
MIM | 610635 |
UniProt ID | Q96CG8 |
◆ Recombinant Proteins | ||
CTHRC1-1656R | Recombinant Rat CTHRC1 protein(Met1-Lys230), His-tagged | +Inquiry |
CTHRC1-1737H | Recombinant Human CTHRC1 Protein (Ser31-Lys243), C-His tagged | +Inquiry |
CTHRC1-1055H | Recombinant Human CTHRC1 protein, hFc-tagged | +Inquiry |
CTHRC1-5254H | Recombinant Human CTHRC1 Protein, His-tagged | +Inquiry |
CTHRC1-3570H | Recombinant Human CTHRC1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTHRC1-2448HCL | Recombinant Human CTHRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTHRC1 Products
Required fields are marked with *
My Review for All CTHRC1 Products
Required fields are marked with *
0
Inquiry Basket