Recombinant Human CTHRC1 protein, His-tagged
Cat.No. : | CTHRC1-3570H |
Product Overview : | Recombinant Human CTHRC1 protein(1-243 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 28, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-243 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CTHRC1 collagen triple helix repeat containing 1 [ Homo sapiens ] |
Official Symbol | CTHRC1 |
Synonyms | CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1; |
Gene ID | 115908 |
mRNA Refseq | NM_001256099 |
Protein Refseq | NP_001243028 |
MIM | 610635 |
UniProt ID | Q96CG8 |
◆ Recombinant Proteins | ||
CTHRC1-3360H | Recombinant Human CTHRC1 Protein, MYC/DDK-tagged | +Inquiry |
CTHRC1-5241H | Recombinant Human CTHRC1 Protein, MBP/His-tagged | +Inquiry |
Cthrc1-1134R | Recombinant Rat Cthrc1 Protein, His-tagged | +Inquiry |
CTHRC1-4024M | Recombinant Mouse CTHRC1 Protein | +Inquiry |
Cthrc1-28M | Recombinant Mouse Cthrc1 protein, FLAG®-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTHRC1-2448HCL | Recombinant Human CTHRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTHRC1 Products
Required fields are marked with *
My Review for All CTHRC1 Products
Required fields are marked with *