Recombinant Human CTHRC1 protein, His-tagged
Cat.No. : | CTHRC1-3570H |
Product Overview : | Recombinant Human CTHRC1 protein(1-243 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-243 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CTHRC1 collagen triple helix repeat containing 1 [ Homo sapiens ] |
Official Symbol | CTHRC1 |
Synonyms | CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1; |
Gene ID | 115908 |
mRNA Refseq | NM_001256099 |
Protein Refseq | NP_001243028 |
MIM | 610635 |
UniProt ID | Q96CG8 |
◆ Recombinant Proteins | ||
CTHRC1-001H | Recombinant Human CTHRC1 Protein, MBP-tagged | +Inquiry |
CTHRC1-3047H | Recombinant Human Collagen Triple Helix Repeat Containing 1 | +Inquiry |
CTHRC1-2053M | Recombinant Mouse CTHRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTHRC1-5711H | Recombinant Human CTHRC1 protein, His&Myc-tagged | +Inquiry |
CTHRC1-3225H | Recombinant Human CTHRC1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTHRC1-2448HCL | Recombinant Human CTHRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTHRC1 Products
Required fields are marked with *
My Review for All CTHRC1 Products
Required fields are marked with *
0
Inquiry Basket