Recombinant Human CTHRC1 protein, His&Myc-tagged

Cat.No. : CTHRC1-5711H
Product Overview : Recombinant Human CTHRC1 protein(31-243aa)(Q96CG8), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 31-243aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 27 kDa
AA Sequence : SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CTHRC1 collagen triple helix repeat containing 1 [ Homo sapiens ]
Official Symbol CTHRC1
Synonyms CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1;
Gene ID 115908
mRNA Refseq NM_001256099
Protein Refseq NP_001243028
MIM 610635
UniProt ID Q96CG8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTHRC1 Products

Required fields are marked with *

My Review for All CTHRC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon