Recombinant Mouse Cthrc1 protein, His-SUMO-tagged
Cat.No. : | Cthrc1-4533M |
Product Overview : | Recombinant Mouse Cthrc1 protein(Q9D1D6)(33-245aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 33-245aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK |
Gene Name | Cthrc1 collagen triple helix repeat containing 1 [ Mus musculus ] |
Official Symbol | Cthrc1 |
Synonyms | CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1; 1110014B07Rik; |
Gene ID | 68588 |
mRNA Refseq | NM_026778 |
Protein Refseq | NP_081054 |
◆ Recombinant Proteins | ||
CTHRC1-2053M | Recombinant Mouse CTHRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTHRC1-3570H | Recombinant Human CTHRC1 protein, His-tagged | +Inquiry |
CTHRC1-28025TH | Recombinant Human CTHRC1 protein, GST-tagged | +Inquiry |
CTHRC1-5241H | Recombinant Human CTHRC1 Protein, MBP/His-tagged | +Inquiry |
CTHRC1-1738H | Recombinant Human CTHRC1 Protein (Ser31-Lys243), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTHRC1-2448HCL | Recombinant Human CTHRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cthrc1 Products
Required fields are marked with *
My Review for All Cthrc1 Products
Required fields are marked with *
0
Inquiry Basket