Recombinant Mouse Cthrc1 protein, His-SUMO-tagged
| Cat.No. : | Cthrc1-4533M |
| Product Overview : | Recombinant Mouse Cthrc1 protein(Q9D1D6)(33-245aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 33-245aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK |
| Gene Name | Cthrc1 collagen triple helix repeat containing 1 [ Mus musculus ] |
| Official Symbol | Cthrc1 |
| Synonyms | CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1; 1110014B07Rik; |
| Gene ID | 68588 |
| mRNA Refseq | NM_026778 |
| Protein Refseq | NP_081054 |
| ◆ Recombinant Proteins | ||
| CTHRC1-3777H | Recombinant Human CTHRC1 protein, rFc-tagged | +Inquiry |
| Cthrc1-28M | Recombinant Mouse Cthrc1 protein, FLAG®-tagged | +Inquiry |
| CTHRC1-1055H | Recombinant Human CTHRC1 protein, hFc-tagged | +Inquiry |
| CTHRC1-001H | Recombinant Human CTHRC1 Protein, MBP-tagged | +Inquiry |
| CTHRC1-680H | Recombinant Human CTHRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTHRC1-2448HCL | Recombinant Human CTHRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cthrc1 Products
Required fields are marked with *
My Review for All Cthrc1 Products
Required fields are marked with *
