Recombinant Human CTNNA2, His-tagged
Cat.No. : | CTNNA2-27148TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 681-905 of Human alpha 2 Catenin isoform 2, with N terminal His tag, 225aa, MWt 26kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 681-905 a.a. |
Description : | It has been shown that alpha N-catenin, a linker between cadherin adhesion receptors and the actin cytoskeleton, is essential for stabilizing dendritic spines in rodent hippocampal neurons in culture. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 80 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKL ARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVK AEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKA SYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKP EEFQTRVRRGSQKKHISPVQALSEFKAMDSF |
Gene Name | CTNNA2 catenin (cadherin-associated protein), alpha 2 [ Homo sapiens ] |
Official Symbol | CTNNA2 |
Synonyms | CTNNA2; catenin (cadherin-associated protein), alpha 2; catenin alpha-2; cadherin associated protein; related; cancer/testis antigen 114; CAP R; CT114; |
Gene ID | 1496 |
mRNA Refseq | NM_004389 |
Protein Refseq | NP_004380 |
MIM | 114025 |
Uniprot ID | P26232 |
Chromosome Location | 2p12-p11.1 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; |
Function | cadherin binding; protein binding; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
CTNNA2-1079R | Recombinant Rhesus monkey CTNNA2 Protein, His-tagged | +Inquiry |
CTNNA2-11670H | Recombinant Human CTNNA2, GST-tagged | +Inquiry |
CTNNA2-4029M | Recombinant Mouse CTNNA2 Protein | +Inquiry |
CTNNA2-27148TH | Recombinant Human CTNNA2, His-tagged | +Inquiry |
CTNNA2-2056M | Recombinant Mouse CTNNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTNNA2-7202HCL | Recombinant Human CTNNA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNNA2 Products
Required fields are marked with *
My Review for All CTNNA2 Products
Required fields are marked with *