Recombinant Human CTNNBIP1, His-tagged

Cat.No. : CTNNBIP1-28030TH
Product Overview : Recombinant full length Human CTNNBIP1 with N terminal His tag; 101 amino acids with tag, MWt 11.3kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 81 amino acids
Description : The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene.
Conjugation : HIS
Molecular Weight : 11.300kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Sequence Similarities : Belongs to the CTNNBIP1 family.
Gene Name CTNNBIP1 catenin, beta interacting protein 1 [ Homo sapiens ]
Official Symbol CTNNBIP1
Synonyms CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093;
Gene ID 56998
mRNA Refseq NM_001012329
Protein Refseq NP_001012329
MIM 607758
Uniprot ID Q9NSA3
Chromosome Location 1pter-p36.31
Pathway Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function armadillo repeat domain binding; beta-catenin binding; beta-catenin binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNNBIP1 Products

Required fields are marked with *

My Review for All CTNNBIP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon