Recombinant Human CTNNBIP1, His-tagged
Cat.No. : | CTNNBIP1-28030TH |
Product Overview : | Recombinant full length Human CTNNBIP1 with N terminal His tag; 101 amino acids with tag, MWt 11.3kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 81 amino acids |
Description : | The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 11.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ |
Sequence Similarities : | Belongs to the CTNNBIP1 family. |
Gene Name | CTNNBIP1 catenin, beta interacting protein 1 [ Homo sapiens ] |
Official Symbol | CTNNBIP1 |
Synonyms | CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093; |
Gene ID | 56998 |
mRNA Refseq | NM_001012329 |
Protein Refseq | NP_001012329 |
MIM | 607758 |
Uniprot ID | Q9NSA3 |
Chromosome Location | 1pter-p36.31 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; |
Function | armadillo repeat domain binding; beta-catenin binding; beta-catenin binding; protein binding; |
◆ Recombinant Proteins | ||
CTNNBIP1-2084H | Recombinant Human CTNNBIP1 Protein, GST-tagged | +Inquiry |
CTNNBIP1-5814H | Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTNNBIP1-1844HFL | Recombinant Full Length Human CTNNBIP1 Protein, C-Flag-tagged | +Inquiry |
CTNNBIP1-5580H | Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTNNBIP1-906R | Recombinant Rhesus Macaque CTNNBIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNNBIP1 Products
Required fields are marked with *
My Review for All CTNNBIP1 Products
Required fields are marked with *