Recombinant Human CTNNBIP1 Protein, GST-tagged
Cat.No. : | CTNNBIP1-2084H |
Product Overview : | Human CTNNBIP1 full-length ORF ( ABZ92405.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 9 kDa |
AA Sequence : | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTNNBIP1 catenin, beta interacting protein 1 [ Homo sapiens ] |
Official Symbol | CTNNBIP1 |
Synonyms | CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093; inhibitor of beta-catenin and Tcf-4; beta-catenin-interacting protein ICAT; |
Gene ID | 56998 |
mRNA Refseq | NM_001012329 |
Protein Refseq | NP_001012329 |
MIM | 607758 |
UniProt ID | Q9NSA3 |
◆ Recombinant Proteins | ||
CTNNBIP1-28030TH | Recombinant Human CTNNBIP1, His-tagged | +Inquiry |
CTNNBIP1-5580H | Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTNNBIP1-906R | Recombinant Rhesus Macaque CTNNBIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTNNBIP1-5814H | Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTNNBIP1-11672H | Recombinant Human CTNNBIP1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNNBIP1 Products
Required fields are marked with *
My Review for All CTNNBIP1 Products
Required fields are marked with *
0
Inquiry Basket