Recombinant Human CTNND1
Cat.No. : | CTNND1-26995TH |
Product Overview : | Recombinant fragment of Human delta 1 Catenin with N terminal proprietary tag; predicted MWt: 37.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in vascular endothelium. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDST LPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNE RGDHNKTLDRSGDLGDMEPLKGTTPLMQKI |
Sequence Similarities : | Belongs to the beta-catenin family.Contains 10 ARM repeats. |
Gene Name : | CTNND1 catenin (cadherin-associated protein), delta 1 [ Homo sapiens ] |
Official Symbol : | CTNND1 |
Synonyms : | CTNND1; catenin (cadherin-associated protein), delta 1; CTNND; catenin delta-1; KIAA0384; p120; p120cas; p120ctn; |
Gene ID : | 1500 |
mRNA Refseq : | NM_001085458 |
Protein Refseq : | NP_001078927 |
MIM : | 601045 |
Uniprot ID : | O60716 |
Chromosome Location : | 11q12.1 |
Pathway : | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Cell junction organization, organism-specific biosystem; |
Function : | RPTP-like protein binding; cadherin binding; protein binding; protein domain specific binding; protein phosphatase binding; |
Products Types
◆ Recombinant Protein | ||
CTNND1-15H | Recombinant Human CTNND1 Protein, His-tagged | +Inquiry |
CTNND1-12H | Recombinant Human CTNND1 Protein, N-His6ABP-tagged | +Inquiry |
Ctnnd1-780M | Recombinant Mouse Ctnnd1 Protein, MYC/DDK-tagged | +Inquiry |
CTNND1-2058M | Recombinant Mouse CTNND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTNND1-1289H | Recombinant Human CTNND1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
CTNND1-419HCL | Recombinant Human CTNND1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket