Recombinant Human CTNND1

Cat.No. : CTNND1-26995TH
Product Overview : Recombinant fragment of Human delta 1 Catenin with N terminal proprietary tag; predicted MWt: 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Expressed in vascular endothelium.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDST LPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNE RGDHNKTLDRSGDLGDMEPLKGTTPLMQKI
Sequence Similarities : Belongs to the beta-catenin family.Contains 10 ARM repeats.
Gene Name CTNND1 catenin (cadherin-associated protein), delta 1 [ Homo sapiens ]
Official Symbol CTNND1
Synonyms CTNND1; catenin (cadherin-associated protein), delta 1; CTNND; catenin delta-1; KIAA0384; p120; p120cas; p120ctn;
Gene ID 1500
mRNA Refseq NM_001085458
Protein Refseq NP_001078927
MIM 601045
Uniprot ID O60716
Chromosome Location 11q12.1
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Cell junction organization, organism-specific biosystem;
Function RPTP-like protein binding; cadherin binding; protein binding; protein domain specific binding; protein phosphatase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNND1 Products

Required fields are marked with *

My Review for All CTNND1 Products

Required fields are marked with *

0
cart-icon