Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CTNND1

Cat.No. : CTNND1-26995TH
Product Overview : Recombinant fragment of Human delta 1 Catenin with N terminal proprietary tag; predicted MWt: 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in vascular endothelium.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDST LPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNE RGDHNKTLDRSGDLGDMEPLKGTTPLMQKI
Sequence Similarities : Belongs to the beta-catenin family.Contains 10 ARM repeats.
Gene Name : CTNND1 catenin (cadherin-associated protein), delta 1 [ Homo sapiens ]
Official Symbol : CTNND1
Synonyms : CTNND1; catenin (cadherin-associated protein), delta 1; CTNND; catenin delta-1; KIAA0384; p120; p120cas; p120ctn;
Gene ID : 1500
mRNA Refseq : NM_001085458
Protein Refseq : NP_001078927
MIM : 601045
Uniprot ID : O60716
Chromosome Location : 11q12.1
Pathway : Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Cell junction organization, organism-specific biosystem;
Function : RPTP-like protein binding; cadherin binding; protein binding; protein domain specific binding; protein phosphatase binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends