Recombinant Human CTNS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CTNS-4113H |
Product Overview : | CTNS MS Standard C13 and N15-labeled recombinant protein (NP_004928) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 41.6 kDa |
AA Sequence : | MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSNDVFFSLHAVVLTLIIIVQCCLYERGGQRVSWPAIGFLVLAWLFAFVTMIVAAVGVITWLQFLFCFSYIKLAVTLVKYFPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYRKRPGYDQLNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CTNS cystinosin, lysosomal cystine transporter [ Homo sapiens (human) ] |
Official Symbol | CTNS |
Synonyms | CTNS; cystinosin, lysosomal cystine transporter; cystinosis, nephropathic; cystinosin; CTNS LSB; PQLC4; CTNS-LSB; |
Gene ID | 1497 |
mRNA Refseq | NM_004937 |
Protein Refseq | NP_004928 |
MIM | 606272 |
UniProt ID | O60931 |
◆ Recombinant Proteins | ||
CTNS-2059M | Recombinant Mouse CTNS Protein, His (Fc)-Avi-tagged | +Inquiry |
CTNS-4113H | Recombinant Human CTNS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTNS-4037M | Recombinant Mouse CTNS Protein | +Inquiry |
RFL34696MF | Recombinant Full Length Mouse Cystinosin(Ctns) Protein, His-Tagged | +Inquiry |
CTNS-2320HF | Recombinant Full Length Human CTNS Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTNS-7199HCL | Recombinant Human CTNS 293 Cell Lysate | +Inquiry |
CTNS-7198HCL | Recombinant Human CTNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNS Products
Required fields are marked with *
My Review for All CTNS Products
Required fields are marked with *