Recombinant Human CTPS2 protein(191-330 aa), C-His-tagged

Cat.No. : CTPS2-11H
Product Overview : Recombinant Human CTPS2 protein(191-330 aa)(Q9NRF8), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 191-330 aa
Form : 0.15 M Phosphate buffered saline
Storage : Store at -20°C to -80°C for 12 months in lyophilized form. After reconstitution, if not intended for use within a month, aliquot and store at -80°C (Avoid repeated freezing and thawing). Lyophilized proteins are shipped at ambient temperature.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINH
Gene Name CTPS2 CTP synthase II [ Homo sapiens ]
Official Symbol CTPS2
Synonyms CTPS2; CTP synthase II; CTP synthase 2; CTP synthetase 2; UTP-ammonia ligase; CTP synthetase type 2; UTP--ammonia ligase 2; CTP synthetase isoform; cytidine 5-triphosphate synthetase 2; FLJ43358; MGC32997; DKFZp686C17207
Gene ID 56474
mRNA Refseq NM_001144002
Protein Refseq NP_001137474
MIM 300380
UniProt ID Q9NRF8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTPS2 Products

Required fields are marked with *

My Review for All CTPS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon