Recombinant Human CTPS2 protein(191-330 aa), C-His-tagged
Cat.No. : | CTPS2-11H |
Product Overview : | Recombinant Human CTPS2 protein(191-330 aa)(Q9NRF8), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 191-330 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Store at -20°C to -80°C for 12 months in lyophilized form. After reconstitution, if not intended for use within a month, aliquot and store at -80°C (Avoid repeated freezing and thawing). Lyophilized proteins are shipped at ambient temperature. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINH |
Gene Name | CTPS2 CTP synthase II [ Homo sapiens ] |
Official Symbol | CTPS2 |
Synonyms | CTPS2; CTP synthase II; CTP synthase 2; CTP synthetase 2; UTP-ammonia ligase; CTP synthetase type 2; UTP--ammonia ligase 2; CTP synthetase isoform; cytidine 5-triphosphate synthetase 2; FLJ43358; MGC32997; DKFZp686C17207 |
Gene ID | 56474 |
mRNA Refseq | NM_001144002 |
Protein Refseq | NP_001137474 |
MIM | 300380 |
UniProt ID | Q9NRF8 |
◆ Recombinant Proteins | ||
Ctps2-2365M | Recombinant Mouse Ctps2 Protein, Myc/DDK-tagged | +Inquiry |
CTPS2-6360H | Recombinant Human CTPS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTPS2-2505C | Recombinant Chicken CTPS2 | +Inquiry |
CTPS2-11H | Recombinant Human CTPS2 protein(191-330 aa), C-His-tagged | +Inquiry |
CTPS2-20HFL | Recombinant Full Length Human CTPS2 Protein, transcript variant 2, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTPS2-7196HCL | Recombinant Human CTPS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTPS2 Products
Required fields are marked with *
My Review for All CTPS2 Products
Required fields are marked with *
0
Inquiry Basket