Recombinant Human CTPS2 protein(191-330 aa), C-His-tagged
| Cat.No. : | CTPS2-11H |
| Product Overview : | Recombinant Human CTPS2 protein(191-330 aa)(Q9NRF8), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 191-330 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Store at -20°C to -80°C for 12 months in lyophilized form. After reconstitution, if not intended for use within a month, aliquot and store at -80°C (Avoid repeated freezing and thawing). Lyophilized proteins are shipped at ambient temperature. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | EQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINH |
| Gene Name | CTPS2 CTP synthase II [ Homo sapiens ] |
| Official Symbol | CTPS2 |
| Synonyms | CTPS2; CTP synthase II; CTP synthase 2; CTP synthetase 2; UTP-ammonia ligase; CTP synthetase type 2; UTP--ammonia ligase 2; CTP synthetase isoform; cytidine 5-triphosphate synthetase 2; FLJ43358; MGC32997; DKFZp686C17207 |
| Gene ID | 56474 |
| mRNA Refseq | NM_001144002 |
| Protein Refseq | NP_001137474 |
| MIM | 300380 |
| UniProt ID | Q9NRF8 |
| ◆ Recombinant Proteins | ||
| CTPS2-1318R | Recombinant Rat CTPS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTPS2-6360H | Recombinant Human CTPS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Ctps2-2365M | Recombinant Mouse Ctps2 Protein, Myc/DDK-tagged | +Inquiry |
| CTPS2-1905H | Recombinant Human CTPS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CTPS2-2505C | Recombinant Chicken CTPS2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTPS2-7196HCL | Recombinant Human CTPS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTPS2 Products
Required fields are marked with *
My Review for All CTPS2 Products
Required fields are marked with *



