Recombinant Human CTSL3P Protein, GST-tagged

• Cat.No.: CTSL3P-2116H
• Product Overview: Human CTSL3 full-length ORF ( AAI60188.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CTSL3P (Cathepsin L Family Member 3, Pseudogene) is a Pseudogene. GO annotations related to this gene include cysteine-type peptidase activity.
• Molecular Mass: 24 kDa
• AA Sequence: MKMIEQHNQEYREGKHSFTMAMNAFGEMTSEEFRQVVNGFQNQKHRKGKVLQEPLLHDIRKSVDWREKGYVTPVKDQCSWGSVRTDVRKTEKLVSLSVQTWWTALGFKAMLAAFLENHYFASSMLPTMEAWTLRNPFHMKKSSGDWKVQGHRGASGESLLASGESQQSPEVAQYSGKHQVQCHLIEEALQMLSGGDEDHDEDKWPHDMRNHLAGEAQV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTSL3P cathepsin L family member 3, pseudogene [ Homo sapiens (human) ]
• Official Symbol: CTSL3P
• Synonyms: CTSL3P; cathepsin L family member 3, pseudogene; Cathepsin L Family Member 3, Pseudogene; HCTSL-S; CTSL3; Cathepsin L Family Member 3; Cathepsin L-Like Protein; Cathepsin L3 Pseudogene; EC 3.4.22
• Gene ID: 392360
• UniProt ID: Q5NE16