Recombinant Human CTSO protein, MBP&His-tagged
Cat.No. : | CTSO-2213H |
Product Overview : | Recombinant Human CTSO protein(P43234)(108-321aa), fused to N-terminal MBP tag and C-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&MBP |
Protein Length : | 108-321aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 67.5 kDa |
AA Sequence : | LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CTSO cathepsin O [ Homo sapiens ] |
Official Symbol | CTSO |
Synonyms | CTSO; cathepsin O; CTSO1; |
Gene ID | 1519 |
mRNA Refseq | NM_001334 |
Protein Refseq | NP_001325 |
MIM | 600550 |
UniProt ID | P43234 |
◆ Recombinant Proteins | ||
CTSO-2801C | Recombinant Chicken CTSO | +Inquiry |
CTSO-2117H | Recombinant Human CTSO Protein, GST-tagged | +Inquiry |
CTSO-2362HF | Recombinant Full Length Human CTSO Protein, GST-tagged | +Inquiry |
CTSO-2072M | Recombinant Mouse CTSO Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSO-2213H | Recombinant Human CTSO protein, MBP&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSO-7190HCL | Recombinant Human CTSO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSO Products
Required fields are marked with *
My Review for All CTSO Products
Required fields are marked with *
0
Inquiry Basket