Recombinant Human CTSV Protein, GST-tagged
Cat.No. : | CTSV-2115H |
Product Overview : | Human CTSL2 full-length ORF ( NP_001324.2, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that may play an important role in corneal physiology. This gene is expressed in colorectal and breast carcinomas but not in normal colon, mammary gland, or peritumoral tissues, suggesting a possible role for this gene in tumor processes. Alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2011] |
Molecular Mass : | 63.7 kDa |
AA Sequence : | MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTSV cathepsin V [ Homo sapiens (human) ] |
Official Symbol | CTSV |
Synonyms | CTSL2; cathepsin L2; CTSU; CTSV; cathepsin U; cathepsin V; cathepsin L2, preproprotein; CATL2; MGC125957; |
Gene ID | 1515 |
mRNA Refseq | NM_001201575 |
Protein Refseq | NP_001188504 |
MIM | 603308 |
UniProt ID | O60911 |
◆ Recombinant Proteins | ||
CTSV-2359HF | Recombinant Full Length Human CTSV Protein, GST-tagged | +Inquiry |
CTSV-1892H | Recombinant Human CTSV Protein (Gly64-Val334), His tagged | +Inquiry |
CTSV-3269H | Active Recombinant Human CTSV protein(Met1-Val334), His-tagged | +Inquiry |
CTSV-0871H | Recombinant Human CTSV Protein (Val18-Val334), C-His tagged | +Inquiry |
CTSV-1009H | Active Recombinant Human CTSV Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSV-2559HCL | Recombinant Human CTSV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSV Products
Required fields are marked with *
My Review for All CTSV Products
Required fields are marked with *