Recombinant Human CTSW Protein, GST-tagged
| Cat.No. : | CTSW-2119H | 
| Product Overview : | Human CTSW full-length ORF ( AAH48255, 22 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The protein encoded by this gene, a member of the peptidase C1 family, is a cysteine proteinase that may have a specific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associated with the membrane inside the endoplasmic reticulum of natural killer and cytotoxic T-cells. Expression of this gene is up-regulated by interleukin-2. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 64.79 kDa | 
| AA Sequence : | IRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCPP | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CTSW cathepsin W [ Homo sapiens ] | 
| Official Symbol | CTSW | 
| Synonyms | CTSW; cathepsin W; cathepsin W (lymphopain); lymphopain; LYPN; | 
| Gene ID | 1521 | 
| mRNA Refseq | NM_001335 | 
| Protein Refseq | NP_001326 | 
| MIM | 602364 | 
| UniProt ID | P56202 | 
| ◆ Recombinant Proteins | ||
| CTSW-1894H | Recombinant Human CTSW Protein (Ile22-Pro376), N-His tagged | +Inquiry | 
| Ctsw-8184M | Recombinant Mouse Ctsw protein, His & T7-tagged | +Inquiry | 
| Ctsw-2768M | Recombinant Mouse Ctsw protein, His&Myc-tagged | +Inquiry | 
| CTSW-2073M | Recombinant Mouse CTSW Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CTSW-404H | Recombinant Human cathepsin W, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSW Products
Required fields are marked with *
My Review for All CTSW Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            