Recombinant Human CUL1, His-tagged
| Cat.No. : | CUL1-28050TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 525-776 of Human Cullin 1 with N terminal His tag; Predicted MWt 30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 525-776 a.a. |
| Description : | Cullin1, also known CUL1, is a core component of multiple cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of proteins involved in cell cycle progression, signal transduction and tran |
| Conjugation : | HIS |
| Tissue specificity : | Expressed in lung fibroblasts. |
| Form : | Lyophilised:Reconstitute with 83 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQ RFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQ ASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVL QILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRI MKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDIL IEKEYLERVDGEKDTYSYLA |
| Sequence Similarities : | Belongs to the cullin family. |
| Gene Name | CUL1 cullin 1 [ Homo sapiens ] |
| Official Symbol | CUL1 |
| Synonyms | CUL1; cullin 1; cullin-1; |
| Gene ID | 8454 |
| mRNA Refseq | NM_003592 |
| Protein Refseq | NP_003583 |
| MIM | 603134 |
| Uniprot ID | Q13616 |
| Chromosome Location | 7q36.1 |
| Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; |
| Function | protein binding; ubiquitin protein ligase binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUL1 Products
Required fields are marked with *
My Review for All CUL1 Products
Required fields are marked with *



