Recombinant Human CUTC, His-tagged
| Cat.No. : | CUTC-26654TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-273 of Human CUTC with N terminal His tag, Predicted MWt 30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-273 a.a. |
| Description : | Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al. |
| Conjugation : | HIS |
| Tissue specificity : | Ubiquitous. |
| Form : | Lyophilised:Reconstitute with 81 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVN AERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPV FVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVF GALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDP MAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKG RIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRDSG MKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKN ILV |
| Sequence Similarities : | Belongs to the CutC family. |
| Full Length : | Full L. |
| Gene Name | CUTC cutC copper transporter homolog (E. coli) [ Homo sapiens ] |
| Official Symbol | CUTC |
| Synonyms | CUTC; cutC copper transporter homolog (E. coli); copper homeostasis protein cutC homolog; CGI 32; |
| Gene ID | 51076 |
| mRNA Refseq | NM_015960 |
| Protein Refseq | NP_057044 |
| MIM | 610101 |
| Uniprot ID | Q9NTM9 |
| Chromosome Location | 10q24.31 |
| Function | copper ion binding; copper ion binding; copper ion binding; metal ion binding; |
| ◆ Recombinant Proteins | ||
| CUTC-1835H | Recombinant Human CUTC protein, His & S-tagged | +Inquiry |
| CUTC-26654TH | Recombinant Human CUTC, His-tagged | +Inquiry |
| Cutc-2381M | Recombinant Mouse Cutc Protein, Myc/DDK-tagged | +Inquiry |
| CUTC-1642C | Recombinant Chicken CUTC | +Inquiry |
| CUTC-3383H | Recombinant Human CUTC Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CUTC-423HCL | Recombinant Human CUTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUTC Products
Required fields are marked with *
My Review for All CUTC Products
Required fields are marked with *
