Recombinant Human CUTC, His-tagged
Cat.No. : | CUTC-26654TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-273 of Human CUTC with N terminal His tag, Predicted MWt 30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-273 a.a. |
Description : | Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 81 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVN AERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPV FVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVF GALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDP MAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKG RIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRDSG MKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKN ILV |
Sequence Similarities : | Belongs to the CutC family. |
Full Length : | Full L. |
Gene Name | CUTC cutC copper transporter homolog (E. coli) [ Homo sapiens ] |
Official Symbol | CUTC |
Synonyms | CUTC; cutC copper transporter homolog (E. coli); copper homeostasis protein cutC homolog; CGI 32; |
Gene ID | 51076 |
mRNA Refseq | NM_015960 |
Protein Refseq | NP_057044 |
MIM | 610101 |
Uniprot ID | Q9NTM9 |
Chromosome Location | 10q24.31 |
Function | copper ion binding; copper ion binding; copper ion binding; metal ion binding; |
◆ Recombinant Proteins | ||
CUTC-3383H | Recombinant Human CUTC Protein, MYC/DDK-tagged | +Inquiry |
CUTC-2401HF | Recombinant Full Length Human CUTC Protein, GST-tagged | +Inquiry |
CUTC-4083M | Recombinant Mouse Cutc Protein, MYC/DDK-tagged | +Inquiry |
CUTC-3904H | Recombinant Human CUTC protein, His-tagged | +Inquiry |
CUTC-1642C | Recombinant Chicken CUTC | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUTC-423HCL | Recombinant Human CUTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUTC Products
Required fields are marked with *
My Review for All CUTC Products
Required fields are marked with *