Recombinant Human CUX2 Protein, GST-tagged
| Cat.No. : | CUX2-2140H |
| Product Overview : | Human CUTL2 partial ORF ( NP_056082.1, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein which contains three CUT domains and a homeodomain; both domains are DNA-binding motifs. A similar gene, whose gene product possesses different DNA-binding activities, is located on chromosome on chromosome 7. Two pseudogenes of this gene have been identified on chromosomes 10 and 4. [provided by RefSeq, Jan 2013] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CUX2 cut-like homeobox 2 [ Homo sapiens (human) ] |
| Official Symbol | CUX2 |
| Synonyms | CDP2; Cut like homeobox 2; Cut-like 2; CUTL2; Cux2; CUX2_HUMAN; Homeobox protein cut-like 2; Homeobox protein cux 2; Homeobox protein Cux-2; KIAA0293; |
| Gene ID | 23316 |
| mRNA Refseq | NM_015267.3 |
| Protein Refseq | NP_056082.2 |
| MIM | 610648 |
| UniProt ID | O14529 |
| ◆ Recombinant Proteins | ||
| CUX2-2085M | Recombinant Mouse CUX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cux2-4859M | Recombinant Mouse Cux2 protein | +Inquiry |
| Cux2-4861M | Recombinant Mouse Cux2 protein, Avi-tagged, Biotinylated | +Inquiry |
| CUX2-11710H | Recombinant Human CUX2, GST-tagged | +Inquiry |
| Cux2-4860M | Recombinant Mouse Cux2 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUX2 Products
Required fields are marked with *
My Review for All CUX2 Products
Required fields are marked with *
