Recombinant Human CUX2 Protein, GST-tagged
Cat.No. : | CUX2-2140H |
Product Overview : | Human CUTL2 partial ORF ( NP_056082.1, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which contains three CUT domains and a homeodomain; both domains are DNA-binding motifs. A similar gene, whose gene product possesses different DNA-binding activities, is located on chromosome on chromosome 7. Two pseudogenes of this gene have been identified on chromosomes 10 and 4. [provided by RefSeq, Jan 2013] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CUX2 cut-like homeobox 2 [ Homo sapiens (human) ] |
Official Symbol | CUX2 |
Synonyms | CDP2; Cut like homeobox 2; Cut-like 2; CUTL2; Cux2; CUX2_HUMAN; Homeobox protein cut-like 2; Homeobox protein cux 2; Homeobox protein Cux-2; KIAA0293; |
Gene ID | 23316 |
mRNA Refseq | NM_015267.3 |
Protein Refseq | NP_056082.2 |
MIM | 610648 |
UniProt ID | O14529 |
◆ Recombinant Proteins | ||
CUX2-2140H | Recombinant Human CUX2 Protein, GST-tagged | +Inquiry |
CUX2-2614H | Recombinant Human CUX2 protein, His-tagged | +Inquiry |
Cux2-4860M | Recombinant Mouse Cux2 protein | +Inquiry |
Cux2-4862M | Recombinant Mouse Cux2 protein | +Inquiry |
Cux2-4861M | Recombinant Mouse Cux2 protein, Avi-tagged, Biotinylated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUX2 Products
Required fields are marked with *
My Review for All CUX2 Products
Required fields are marked with *
0
Inquiry Basket