Recombinant Human CUX2 Protein, GST-tagged

• Cat.No.: CUX2-2140H
• Product Overview: Human CUTL2 partial ORF ( NP_056082.1, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which contains three CUT domains and a homeodomain; both domains are DNA-binding motifs. A similar gene, whose gene product possesses different DNA-binding activities, is located on chromosome on chromosome 7. Two pseudogenes of this gene have been identified on chromosomes 10 and 4. [provided by RefSeq, Jan 2013]
• Molecular Mass: 36.74 kDa
• AA Sequence: FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CUX2 cut-like homeobox 2 [ Homo sapiens (human) ]
• Official Symbol: CUX2
• Synonyms: CDP2; Cut like homeobox 2; Cut-like 2; CUTL2; Cux2; CUX2_HUMAN; Homeobox protein cut-like 2; Homeobox protein cux 2; Homeobox protein Cux-2; KIAA0293
• Gene ID: 23316
• mRNA Refseq: NM_015267.3
• Protein Refseq: NP_056082.2
• MIM: 610648
• UniProt ID: O14529