Recombinant Human CUZD1 Protein, GST-tagged

Cat.No. : CUZD1-2142H
Product Overview : Human CUZD1 partial ORF ( NP_071317, 471 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CUZD1 (CUB And Zona Pellucida Like Domains 1) is a Protein Coding gene. An important paralog of this gene is GP2.
Molecular Mass : 36.74 kDa
AA Sequence : YPLFGHYGRFQFNAFKFLRSMSSVYLQCKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEETPNQPFNSVH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CUZD1 CUB and zona pellucida-like domains 1 [ Homo sapiens ]
Official Symbol CUZD1
Synonyms ERG-1; UO-44
Gene ID 50624
mRNA Refseq NM_022034.5
Protein Refseq NP_071317.2
MIM 616644
UniProt ID Q86UP6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CUZD1 Products

Required fields are marked with *

My Review for All CUZD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon