Recombinant Human CUZD1 Protein, GST-tagged

• Cat.No.: CUZD1-2142H
• Product Overview: Human CUZD1 partial ORF ( NP_071317, 471 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CUZD1 (CUB And Zona Pellucida Like Domains 1) is a Protein Coding gene. An important paralog of this gene is GP2.
• Molecular Mass: 36.74 kDa
• AA Sequence: YPLFGHYGRFQFNAFKFLRSMSSVYLQCKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEETPNQPFNSVH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CUZD1 CUB and zona pellucida-like domains 1 [ Homo sapiens ]
• Official Symbol: CUZD1
• Synonyms: ERG-1; UO-44
• Gene ID: 50624
• mRNA Refseq: NM_022034.5
• Protein Refseq: NP_071317.2
• MIM: 616644
• UniProt ID: Q86UP6