Recombinant Human CXCL8 protein, GST-tagged

Cat.No. : CXCL8-3703H
Product Overview : Recombinant Human CXCL8 protein(40-99 aa), fused to GST tag, was expressed in E. coli.
Availability August 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 40-99 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : YSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ]
Official Symbol CXCL8
Synonyms CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1
Gene ID 3576
mRNA Refseq NM_000584.4
Protein Refseq NP_000575.1
MIM 146930
UniProt ID P10145

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL8 Products

Required fields are marked with *

My Review for All CXCL8 Products

Required fields are marked with *

0
cart-icon