Recombinant Human CXCL8 protein, GST-tagged
Cat.No. : | CXCL8-3703H |
Product Overview : | Recombinant Human CXCL8 protein(40-99 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 40-99 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | YSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ] |
Official Symbol | CXCL8 |
Synonyms | CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1 |
Gene ID | 3576 |
mRNA Refseq | NM_000584.4 |
Protein Refseq | NP_000575.1 |
MIM | 146930 |
UniProt ID | P10145 |
◆ Recombinant Proteins | ||
CXCL8-3108C | Recombinant Chicken CXCL8 protein, His-tagged | +Inquiry |
CXCL8-693H | Recombinant Human CXCL8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL8-350C | Active Recombinant Human CXCL8 Protein (77 aa) | +Inquiry |
CXCL8-1111R | Recombinant Rhesus monkey CXCL8 Protein, His-tagged | +Inquiry |
CXCL8-123H | Recombinant Human CXCL8 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL8 Products
Required fields are marked with *
My Review for All CXCL8 Products
Required fields are marked with *