Recombinant Human CXCL8 protein, GST-tagged
| Cat.No. : | CXCL8-3703H |
| Product Overview : | Recombinant Human CXCL8 protein(40-99 aa), fused to GST tag, was expressed in E. coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 40-99 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | YSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ] |
| Official Symbol | CXCL8 |
| Synonyms | CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1 |
| Gene ID | 3576 |
| mRNA Refseq | NM_000584.4 |
| Protein Refseq | NP_000575.1 |
| MIM | 146930 |
| UniProt ID | P10145 |
| ◆ Recombinant Proteins | ||
| CXCL8-035H | Recombinant Human CXCL8 Protein, Biotinylated | +Inquiry |
| CXCL8-321H | Active Recombinant Human interleukin 8, MIgG2a Fc-tagged | +Inquiry |
| CXCL8-5677D | Recombinant Dog CXCL8 protein, rFc-tagged | +Inquiry |
| CXCL8-3389H | Recombinant Human CXCL8 Protein, MYC/DDK-tagged | +Inquiry |
| CXCL8-660D | Recombinant Dog CXCL8 protein, His & S-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL8 Products
Required fields are marked with *
My Review for All CXCL8 Products
Required fields are marked with *



