Recombinant Human CXorf40A Protein, GST-tagged

Cat.No. : CXorf40A-2194H
Product Overview : Human CXorf40A full-length ORF ( NP_001013867.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CXorf40A (Chromosome X Open Reading Frame 40A) is a Protein Coding gene. An important paralog of this gene is CXorf40B.
Molecular Mass : 44.2 kDa
AA Sequence : MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDACRELLVERLGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAALTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXorf40A chromosome X open reading frame 40A [ Homo sapiens (human) ]
Official Symbol CXorf40A
Synonyms CXorf40A; chromosome X open reading frame 40A; Chromosome X Open Reading Frame 40A; Endothelial-Overexpressed Lipopolysaccharide-Associated Factor 1; CXorf40; EOLA1; Chromosome X Open Reading Frame 40; Protein CXorf40A; protein CXorf40A; endothelial-overexpressed lipopolysaccharide-associated factor 1
Gene ID 91966
mRNA Refseq NM_001171907
Protein Refseq NP_001165378
MIM 300954
UniProt ID Q8TE69

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXorf40A Products

Required fields are marked with *

My Review for All CXorf40A Products

Required fields are marked with *

0
cart-icon
0
compare icon