Recombinant Full Length Human CXorf40A Protein, GST-tagged

• Cat.No.: CXorf40A-2346HF
• Product Overview: Human CXorf40A full-length ORF ( NP_001013867.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 158 amino acids
• Description: CXorf40A (Chromosome X Open Reading Frame 40A) is a Protein Coding gene. An important paralog of this gene is CXorf40B.
• Molecular Mass: 44.2 kDa
• AA Sequence: MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDACRELLVERLGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAALTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXorf40A chromosome X open reading frame 40A [ Homo sapiens (human) ]
• Official Symbol: CXorf40A
• Synonyms: CXorf40A; chromosome X open reading frame 40A; Chromosome X Open Reading Frame 40A; Endothelial-Overexpressed Lipopolysaccharide-Associated Factor 1; CXorf40; EOLA1; Chromosome X Open Reading Frame 40; Protein CXorf40A; protein CXorf40A; endothelial-overexpressed lipopolysaccharide-associated factor 1
• Gene ID: 91966
• mRNA Refseq: NM_001171907
• Protein Refseq: NP_001165378
• MIM: 300954
• UniProt ID: Q8TE69