Recombinant Full Length Human CXorf40A Protein, GST-tagged
Cat.No. : | CXorf40A-2346HF |
Product Overview : | Human CXorf40A full-length ORF ( NP_001013867.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 158 amino acids |
Description : | CXorf40A (Chromosome X Open Reading Frame 40A) is a Protein Coding gene. An important paralog of this gene is CXorf40B. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDACRELLVERLGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAALTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXorf40A chromosome X open reading frame 40A [ Homo sapiens (human) ] |
Official Symbol | CXorf40A |
Synonyms | CXorf40A; chromosome X open reading frame 40A; Chromosome X Open Reading Frame 40A; Endothelial-Overexpressed Lipopolysaccharide-Associated Factor 1; CXorf40; EOLA1; Chromosome X Open Reading Frame 40; Protein CXorf40A; protein CXorf40A; endothelial-overexpressed lipopolysaccharide-associated factor 1 |
Gene ID | 91966 |
mRNA Refseq | NM_001171907 |
Protein Refseq | NP_001165378 |
MIM | 300954 |
UniProt ID | Q8TE69 |
◆ Recombinant Proteins | ||
CXorf40A-2194H | Recombinant Human CXorf40A Protein, GST-tagged | +Inquiry |
CXorf40A-2346HF | Recombinant Full Length Human CXorf40A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXorf40A-7156HCL | Recombinant Human CXorf40A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXorf40A Products
Required fields are marked with *
My Review for All CXorf40A Products
Required fields are marked with *