Recombinant Human CXXC5 protein, GST-tagged
| Cat.No. : | CXXC5-27H |
| Product Overview : | Recombinant Human CXXC5(1 a.a. - 227 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 227 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 50.5 kDa |
| AA Sequence : | MMGGESADKATAAAAAASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTE MLKRVVQEHLPLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPM QGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELKKKPSAALEKVMLPTGAAFRW FQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CXXC5 CXXC finger protein 5 [ Homo sapiens ] |
| Official Symbol | CXXC5 |
| Synonyms | CF5; WID; RINF; HSPC195 |
| Gene ID | 51523 |
| mRNA Refseq | NM_016463.7 |
| Protein Refseq | NP_057547 |
| MIM | 612752 |
| UniProt ID | Q7LFL8 |
| Chromosome Location | 5q31.2 |
| Function | DNA binding;signal transducer activity;zinc ion binding; |
| ◆ Recombinant Proteins | ||
| CXXC5-3026HFL | Recombinant Full Length Human CXXC5, Flag-tagged | +Inquiry |
| CXXC5-1119R | Recombinant Rhesus monkey CXXC5 Protein, His-tagged | +Inquiry |
| CXXC5-27H | Recombinant Human CXXC5 protein, GST-tagged | +Inquiry |
| CXXC5-2135H | Recombinant Human CXXC5 Protein (Met1-Gln227), N-His tagged | +Inquiry |
| CXXC5-944R | Recombinant Rhesus Macaque CXXC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXXC5-7149HCL | Recombinant Human CXXC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXXC5 Products
Required fields are marked with *
My Review for All CXXC5 Products
Required fields are marked with *
