Recombinant Human CYB5B Protein, GST-tagged

• Cat.No.: CYB5B-2214H
• Product Overview: Human CYB5-M full-length ORF ( AAH04373.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-146 a.a.
• Description: CYB5B (Cytochrome B5 Type B) is a Protein Coding gene. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. GO annotations related to this gene include heme binding and enzyme activator activity. An important paralog of this gene is CYB5A.
• Molecular Mass: 42.7 kDa
• AA Sequence: MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ]
• Official Symbol: CYB5B
• Synonyms: CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619
• Gene ID: 80777
• mRNA Refseq: NM_030579
• Protein Refseq: NP_085056
• MIM: 611964
• UniProt ID: O43169

Q&As

Is there an iron or heme content for this particular product?

The culture medium contains trace elements such as iron (Fe). In theory, these elements should be incorporated into the structure. However, this has not been experimentally verified on the final product.