Recombinant Human CYB5B Protein, GST-tagged
| Cat.No. : | CYB5B-2214H |
| Product Overview : | Human CYB5-M full-length ORF ( AAH04373.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-146 a.a. |
| Description : | CYB5B (Cytochrome B5 Type B) is a Protein Coding gene. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. GO annotations related to this gene include heme binding and enzyme activator activity. An important paralog of this gene is CYB5A. |
| Molecular Mass : | 42.7 kDa |
| AA Sequence : | MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ] |
| Official Symbol | CYB5B |
| Synonyms | CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619; |
| Gene ID | 80777 |
| mRNA Refseq | NM_030579 |
| Protein Refseq | NP_085056 |
| MIM | 611964 |
| UniProt ID | O43169 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5B Products
Required fields are marked with *
My Review for All CYB5B Products
Required fields are marked with *
Recently Viewed
