Recombinant Human CYB5D2 Protein, GST-tagged

• Cat.No.: CYB5D2-2213H
• Product Overview: Human CYB5D2 full-length ORF (BAD18808.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CYB5D2 (Cytochrome B5 Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include heme binding. An important paralog of this gene is NENF.
• Molecular Mass: 55.1 kDa
• AA Sequence: MLRCGGRGLLLGLAVAAAAVMAARLMGWWGPRAGFRLFIPEELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGLVDDVSDLSAAEMLTLHNWLSFYEKNYVCVGRVTGRFYGEDGLPTPALTQVEAAITRGLEANKLQLQEKQTFPPCNAEWSSARGSRLWCSQKSGGVSRDWIGVPRKLYKPGAKEPRCVCVRTTGPPSGQMPDNPPHRNRGDLDHPNLAEYTGCPPLAITCSFPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYB5D2 cytochrome b5 domain containing 2 [ Homo sapiens ]
• Official Symbol: CYB5D2
• Synonyms: CYB5D2; cytochrome b5 domain containing 2; neuferricin; MGC32124; cytochrome b5 domain-containing protein 2
• Gene ID: 124936
• mRNA Refseq: NM_001254755
• Protein Refseq: NP_001241684
• UniProt ID: Q8WUJ1