Recombinant Full Length Human CYB5D2 Protein, GST-tagged

Cat.No. : CYB5D2-2380HF
Product Overview : Human CYB5D2 full-length ORF (BAD18808.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 264 amino acids
Description : CYB5D2 (Cytochrome B5 Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include heme binding. An important paralog of this gene is NENF.
Molecular Mass : 55.1 kDa
AA Sequence : MLRCGGRGLLLGLAVAAAAVMAARLMGWWGPRAGFRLFIPEELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGLVDDVSDLSAAEMLTLHNWLSFYEKNYVCVGRVTGRFYGEDGLPTPALTQVEAAITRGLEANKLQLQEKQTFPPCNAEWSSARGSRLWCSQKSGGVSRDWIGVPRKLYKPGAKEPRCVCVRTTGPPSGQMPDNPPHRNRGDLDHPNLAEYTGCPPLAITCSFPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYB5D2 cytochrome b5 domain containing 2 [ Homo sapiens ]
Official Symbol CYB5D2
Synonyms CYB5D2; cytochrome b5 domain containing 2; neuferricin; MGC32124; cytochrome b5 domain-containing protein 2;
Gene ID 124936
mRNA Refseq NM_001254755
Protein Refseq NP_001241684
UniProt ID Q8WUJ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYB5D2 Products

Required fields are marked with *

My Review for All CYB5D2 Products

Required fields are marked with *

0
cart-icon