Recombinant Human CYBB Protein, GST-tagged

Cat.No. : CYBB-2222H
Product Overview : Human CYBB partial ORF ( AAH32720, 120 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole. [provided by RefSeq, Jul 2008]
Molecular Mass : 31.46 kDa
AA Sequence : LFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYBB cytochrome b-245, beta polypeptide [ Homo sapiens ]
Official Symbol CYBB
Synonyms CYBB; cytochrome b-245, beta polypeptide; CGD, chronic granulomatous disease; cytochrome b-245 heavy chain; GP91 PHOX; NOX2; CGD91-phox; NADPH oxidase 2; p22 phagocyte B-cytochrome; cytochrome b558 subunit beta; cytochrome b(558) subunit beta; neutrophil cytochrome b 91 kDa polypeptide; heme-binding membrane glycoprotein gp91phox; superoxide-generating NADPH oxidase heavy chain subunit; CGD; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX;
Gene ID 1536
mRNA Refseq NM_000397
Protein Refseq NP_000388
MIM 300481
UniProt ID P04839

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYBB Products

Required fields are marked with *

My Review for All CYBB Products

Required fields are marked with *

0
cart-icon