Recombinant Human CYBRD1 protein, His-tagged
Cat.No. : | CYBRD1-2953H |
Product Overview : | Recombinant Human CYBRD1 protein(148-286 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 148-286 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CYBRD1 cytochrome b reductase 1 [ Homo sapiens ] |
Official Symbol | CYBRD1 |
Synonyms | CYBRD1; cytochrome b reductase 1; DCYTB; ferric chelate reductase 3; FLJ23462; FRRS3; duodenal cytochrome b; ferric-chelate reductase 3; |
Gene ID | 79901 |
mRNA Refseq | NM_001127383 |
Protein Refseq | NP_001120855 |
MIM | 605745 |
UniProt ID | Q53TN4 |
◆ Recombinant Proteins | ||
Cybrd1-2405M | Recombinant Mouse Cybrd1 Protein, Myc/DDK-tagged | +Inquiry |
RFL6611XF | Recombinant Full Length Xenopus Tropicalis Cytochrome B Reductase 1(Cybrd1) Protein, His-Tagged | +Inquiry |
CYBRD1-1708R | Recombinant Rat CYBRD1 Protein | +Inquiry |
CYBRD1-2953H | Recombinant Human CYBRD1 protein, His-tagged | +Inquiry |
RFL12381DF | Recombinant Full Length Danio Rerio Cytochrome B Reductase 1(Cybrd1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYBRD1-7137HCL | Recombinant Human CYBRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYBRD1 Products
Required fields are marked with *
My Review for All CYBRD1 Products
Required fields are marked with *
0
Inquiry Basket