Recombinant Human CYP11B2 Protein, His/SUMO-tagged
Cat.No. : | CYP11B2-1179H |
Product Overview : | Recombinant Human CYP11B2 Protein (25-503a) was expressed in E. coli with N-terminal His/SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-503 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 71.0 kDa |
AA Sequence : | GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | CYP11B2 cytochrome P450, family 11, subfamily B, polypeptide 2 [ Homo sapiens ] |
Official Symbol | CYP11B2 |
Gene ID | 1585 |
mRNA Refseq | NM_000498.3 |
Protein Refseq | NP_000489.3 |
MIM | 124080 |
UniProt ID | P19099 |
◆ Recombinant Proteins | ||
CYP11B2-959R | Recombinant Rhesus Macaque CYP11B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP11B2-2190H | Recombinant Human CYP11B2 Protein (25-503 aa), His-tagged | +Inquiry |
CYP11B2-2766H | Recombinant Human CYP11B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP11B2-194H | Recombinant Human CYP11B2 | +Inquiry |
CYP11B2-1179H | Recombinant Human CYP11B2 Protein, His/SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP11B2-7129HCL | Recombinant Human CYP11B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP11B2 Products
Required fields are marked with *
My Review for All CYP11B2 Products
Required fields are marked with *