Recombinant Human CYP11B2 Protein, His/SUMO-tagged
| Cat.No. : | CYP11B2-1179H |
| Product Overview : | Recombinant Human CYP11B2 Protein (25-503a) was expressed in E. coli with N-terminal His/SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 25-503 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 71.0 kDa |
| AA Sequence : | GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | CYP11B2 cytochrome P450, family 11, subfamily B, polypeptide 2 [ Homo sapiens ] |
| Official Symbol | CYP11B2 |
| Gene ID | 1585 |
| mRNA Refseq | NM_000498.3 |
| Protein Refseq | NP_000489.3 |
| MIM | 124080 |
| UniProt ID | P19099 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP11B2 Products
Required fields are marked with *
My Review for All CYP11B2 Products
Required fields are marked with *
