Recombinant Human CYP11B2 Protein, His/SUMO-tagged
| Cat.No. : | CYP11B2-1179H | 
| Product Overview : | Recombinant Human CYP11B2 Protein (25-503a) was expressed in E. coli with N-terminal His/SUMO-tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 25-503 a.a. | 
| Form : | Tris-based buffer, 50% glycerol. | 
| Molecular Mass : | 71.0 kDa | 
| AA Sequence : | GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
| Gene Name | CYP11B2 cytochrome P450, family 11, subfamily B, polypeptide 2 [ Homo sapiens ] | 
| Official Symbol | CYP11B2 | 
| Gene ID | 1585 | 
| mRNA Refseq | NM_000498.3 | 
| Protein Refseq | NP_000489.3 | 
| MIM | 124080 | 
| UniProt ID | P19099 | 
| ◆ Recombinant Proteins | ||
| CYP11B2-1179H | Recombinant Human CYP11B2 Protein, His/SUMO-tagged | +Inquiry | 
| CYP11B2-2766H | Recombinant Human CYP11B2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CYP11B2-194H | Recombinant Human CYP11B2 | +Inquiry | 
| CYP11B2-959R | Recombinant Rhesus Macaque CYP11B2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CYP11B2-2190H | Recombinant Human CYP11B2 Protein (25-503 aa), His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CYP11B2-7129HCL | Recombinant Human CYP11B2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP11B2 Products
Required fields are marked with *
My Review for All CYP11B2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            