Recombinant Human CYP11B2 Protein, His/SUMO-tagged

Cat.No. : CYP11B2-1179H
Product Overview : Recombinant Human CYP11B2 Protein (25-503a) was expressed in E. coli with N-terminal His/SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 25-503 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 71.0 kDa
AA Sequence : GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name CYP11B2 cytochrome P450, family 11, subfamily B, polypeptide 2 [ Homo sapiens ]
Official Symbol CYP11B2
Gene ID 1585
mRNA Refseq NM_000498.3
Protein Refseq NP_000489.3
MIM 124080
UniProt ID P19099

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP11B2 Products

Required fields are marked with *

My Review for All CYP11B2 Products

Required fields are marked with *

0
cart-icon
0
compare icon