Recombinant Human CYP1A2

Cat.No. : CYP1A2-27559TH
Product Overview : Recombinant fragment of Human Cytochrome P450 1A2 with N terminal proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzymes endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3 untranslated region.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL
Sequence Similarities : Belongs to the cytochrome P450 family.
Gene Name CYP1A2 cytochrome P450, family 1, subfamily A, polypeptide 2 [ Homo sapiens ]
Official Symbol CYP1A2
Synonyms CYP1A2; cytochrome P450, family 1, subfamily A, polypeptide 2; cytochrome P450, subfamily I (aromatic compound inducible), polypeptide 2; cytochrome P450 1A2; CP12; P3 450;
Gene ID 1544
mRNA Refseq NM_000761
Protein Refseq NP_000752
Uniprot ID P05177
Chromosome Location 15q24.1
Pathway Aromatic amines can be N-hydroxylated or N-dealkylated by CYP1A2, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Caffeine metabolism, organism-specific biosystem; Caffeine metabolism, conserved biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem;
Function aromatase activity; caffeine oxidase activity; demethylase activity; electron carrier activity; enzyme binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP1A2 Products

Required fields are marked with *

My Review for All CYP1A2 Products

Required fields are marked with *

0
cart-icon