Recombinant Human CYP1A2
Cat.No. : | CYP1A2-27559TH |
Product Overview : | Recombinant fragment of Human Cytochrome P450 1A2 with N terminal proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzymes endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3 untranslated region. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL |
Sequence Similarities : | Belongs to the cytochrome P450 family. |
Gene Name | CYP1A2 cytochrome P450, family 1, subfamily A, polypeptide 2 [ Homo sapiens ] |
Official Symbol | CYP1A2 |
Synonyms | CYP1A2; cytochrome P450, family 1, subfamily A, polypeptide 2; cytochrome P450, subfamily I (aromatic compound inducible), polypeptide 2; cytochrome P450 1A2; CP12; P3 450; |
Gene ID | 1544 |
mRNA Refseq | NM_000761 |
Protein Refseq | NP_000752 |
Uniprot ID | P05177 |
Chromosome Location | 15q24.1 |
Pathway | Aromatic amines can be N-hydroxylated or N-dealkylated by CYP1A2, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Caffeine metabolism, organism-specific biosystem; Caffeine metabolism, conserved biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; |
Function | aromatase activity; caffeine oxidase activity; demethylase activity; electron carrier activity; enzyme binding; |
◆ Recombinant Proteins | ||
CYP1A2-119D | Active Recombinant Dog CYP1A2 Protein | +Inquiry |
CYP1A2-7960H | Recombinant Human CYP1A2 protein, His-tagged | +Inquiry |
Cyp1a2-7961R | Recombinant Rat Cyp1a2 protein, His-tagged | +Inquiry |
CYP1A2-132P | Active Recombinant Pig CYP1A2 Protein | +Inquiry |
Cyp1a2-2413M | Recombinant Mouse Cyp1a2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP1A2-432HCL | Recombinant Human CYP1A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP1A2 Products
Required fields are marked with *
My Review for All CYP1A2 Products
Required fields are marked with *