Recombinant Human CYP27A1 protein, His-tagged
| Cat.No. : | CYP27A1-3977H |
| Product Overview : | Recombinant Human CYP27A1 protein(183-531 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 183-531 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CYP27A1 cytochrome P450, family 27, subfamily A, polypeptide 1 [ Homo sapiens ] |
| Official Symbol | CYP27A1 |
| Synonyms | CYP27A1; cytochrome P450, family 27, subfamily A, polypeptide 1; CYP27, cytochrome P450, subfamily XXVIIA (steroid 27 hydroxylase, cerebrotendinous xanthomatosis), polypeptide 1; sterol 26-hydroxylase, mitochondrial; cerebrotendinous xanthomatosis; CP27; CTX; cytochrome P450 27; sterol 27-hydroxylase; cytochrome P-450C27/25; vitamin D(3) 25-hydroxylase; cholestanetriol 26-monooxygenase; 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase; cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinous xanthomatosis), polypeptide 1; CYP27; |
| Gene ID | 1593 |
| mRNA Refseq | NM_000784 |
| Protein Refseq | NP_000775 |
| MIM | 606530 |
| UniProt ID | Q02318 |
| ◆ Recombinant Proteins | ||
| CYP27A1-2131M | Recombinant Mouse CYP27A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYP27A1-966R | Recombinant Rhesus Macaque CYP27A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYP27A1-1380R | Recombinant Rat CYP27A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYP27A1-1721R | Recombinant Rat CYP27A1 Protein | +Inquiry |
| Cyp27a1-250M | Recombinant Mouse Cyp27a1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYP27A1-7119HCL | Recombinant Human CYP27A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP27A1 Products
Required fields are marked with *
My Review for All CYP27A1 Products
Required fields are marked with *
