Recombinant Human CYP4X1 Protein, GST-tagged
Cat.No. : | CYP4X1-2288H |
Product Overview : | Human CYP4X1 full-length ORF ( AAH28102, 1 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes and is located within a cluster of genes belonging to this superfamily on chromosome 1. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 81.51 kDa |
AA Sequence : | MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNHFILKPKNGMYLHLKKLSEC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYP4X1 cytochrome P450, family 4, subfamily X, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP4X1 |
Synonyms | CYP4X1; cytochrome P450, family 4, subfamily X, polypeptide 1; cytochrome P450 4X1; MGC40051; CYPIVX1; |
Gene ID | 260293 |
mRNA Refseq | NM_178033 |
Protein Refseq | NP_828847 |
MIM | 614999 |
UniProt ID | Q8N118 |
◆ Recombinant Proteins | ||
CYP4X1-2161M | Recombinant Mouse CYP4X1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP4X1-3110H | Recombinant Human CYP4X1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL27367RF | Recombinant Full Length Rat Cytochrome P450 4X1(Cyp4X1) Protein, His-Tagged | +Inquiry |
Cyp4x1-2423M | Recombinant Mouse Cyp4x1 Protein, Myc/DDK-tagged | +Inquiry |
CYP4X1-1755R | Recombinant Rat CYP4X1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP4X1-441HCL | Recombinant Human CYP4X1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP4X1 Products
Required fields are marked with *
My Review for All CYP4X1 Products
Required fields are marked with *