Recombinant Human CYSLTR1 Protein
Cat.No. : | CYSLTR1-2299H |
Product Overview : | Human CYSLTR1 full-length ORF (NP_006630.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Form : | Liquid |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CYSLTR1 cysteinyl leukotriene receptor 1 [ Homo sapiens ] |
Official Symbol | CYSLTR1 |
Synonyms | CYSLTR1; cysteinyl leukotriene receptor 1; CysLT(1); CysLT1; CYSLT1R; LTD4 receptor; G-protein coupled receptor HG55; cysteinyl leukotriene D4 receptor; HG55; CYSLT1; CYSLTR; HMTMF81; MGC46139; |
Gene ID | 10800 |
mRNA Refseq | NM_006639 |
Protein Refseq | NP_006630 |
MIM | 300201 |
UniProt ID | Q9Y271 |
◆ Recombinant Proteins | ||
CYSLTR1-4248M | Recombinant Mouse CYSLTR1 Protein | +Inquiry |
RFL32416HF | Recombinant Human Cysteinyl Leukotriene Receptor 1(Cysltr1) Protein, His-Tagged | +Inquiry |
CYSLTR1-1535H | Recombinant Human CYSLTR1 Full Length Transmembrane protein, His-tagged | +Inquiry |
CYSLTR1-1760R | Recombinant Rat CYSLTR1 Protein | +Inquiry |
CYSLTR1-2167M | Recombinant Mouse CYSLTR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYSLTR1 Products
Required fields are marked with *
My Review for All CYSLTR1 Products
Required fields are marked with *