Recombinant Human CYSLTR2 Protein
Cat.No. : | CYSLTR2-2302H |
Product Overview : | Human CYSLTR2 full-length ORF (NP_065110.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. This encoded receptor is a member of the superfamily of G protein-coupled receptors. It seems to play a major role in endocrine and cardiovascular systems. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CYSLTR2 cysteinyl leukotriene receptor 2 [ Homo sapiens ] |
Official Symbol | CYSLTR2 |
Synonyms | HG57; CYSLT2; HPN321; CYSLT2R; KPG_011; hGPCR21; PSEC0146 |
Gene ID | 57105 |
mRNA Refseq | NM_020377.2 |
Protein Refseq | NP_065110.1 |
MIM | 605666 |
UniProt ID | Q9NS75 |
◆ Cell & Tissue Lysates | ||
CYSLTR2-7096HCL | Recombinant Human CYSLTR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYSLTR2 Products
Required fields are marked with *
My Review for All CYSLTR2 Products
Required fields are marked with *
0
Inquiry Basket