Recombinant Human CYSLTR2 Protein
| Cat.No. : | CYSLTR2-2302H |
| Product Overview : | Human CYSLTR2 full-length ORF (NP_065110.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. This encoded receptor is a member of the superfamily of G protein-coupled receptors. It seems to play a major role in endocrine and cardiovascular systems. [provided by RefSeq, Jul 2008] |
| Form : | Liquid |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | CYSLTR2 cysteinyl leukotriene receptor 2 [ Homo sapiens ] |
| Official Symbol | CYSLTR2 |
| Synonyms | HG57; CYSLT2; HPN321; CYSLT2R; KPG_011; hGPCR21; PSEC0146 |
| Gene ID | 57105 |
| mRNA Refseq | NM_020377.2 |
| Protein Refseq | NP_065110.1 |
| MIM | 605666 |
| UniProt ID | Q9NS75 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYSLTR2 Products
Required fields are marked with *
My Review for All CYSLTR2 Products
Required fields are marked with *
