Recombinant Human Cytomegalovirus EGFP Protein (1-239 aa), His-Myc-tagged

• Cat.No.: EGFP-2153H
• Product Overview: Recombinant Human Cytomegalovirus EGFP Protein (1-239 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Microbiology. Protein Description: Full Length.

Specification

• Species: Human Cytomegalovirus
• Source: Yeast
• Tag: His&Myc
• Protein Length: 1-239 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 30.9 kDa
• AA Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: egfp
• UniProt ID: C5MKY7