Recombinant Human Cytomegalovirus EGFP Protein (1-239 aa), His-Myc-tagged

Cat.No. : EGFP-2153H
Product Overview : Recombinant Human Cytomegalovirus EGFP Protein (1-239 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Microbiology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human Cytomegalovirus
Source : Yeast
Tag : His&Myc
Protein Length : 1-239 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 30.9 kDa
AA Sequence : MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms egfp;
UniProt ID C5MKY7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGFP Products

Required fields are marked with *

My Review for All EGFP Products

Required fields are marked with *

0
cart-icon