Recombinant Human DAAM2 Protein, GST-tagged

Cat.No. : DAAM2-2313H
Product Overview : Human DAAM2 full-length ORF ( AAH47575.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DAAM2 (Dishevelled Associated Activator Of Morphogenesis 2) is a Protein Coding gene. Diseases associated with DAAM2 include Intestinal Volvulus. Among its related pathways are Wnt Signaling Pathway and Pluripotency and WNT Signaling. GO annotations related to this gene include binding and Rho GTPase binding. An important paralog of this gene is DAAM1.
Molecular Mass : 41.3 kDa
AA Sequence : MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DAAM2 dishevelled associated activator of morphogenesis 2 [ Homo sapiens ]
Official Symbol DAAM2
Synonyms DAAM2; dishevelled associated activator of morphogenesis 2; disheveled-associated activator of morphogenesis 2; KIAA0381; dishevelled-associated activator of morphogenesis 2; dJ90A20A.1; RP1-278E11.1; MGC90515;
Gene ID 23500
mRNA Refseq NM_001201427
Protein Refseq NP_001188356
MIM 606627
UniProt ID Q86T65

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAAM2 Products

Required fields are marked with *

My Review for All DAAM2 Products

Required fields are marked with *

0
cart-icon