Recombinant Human DAD1 protein, GST-tagged
Cat.No. : | DAD1-11817H |
Product Overview : | Recombinant Human DAD1 protein(1-113 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | June 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-113 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | DAD1 defender against cell death 1 [ Homo sapiens ] |
Official Symbol | DAD1 |
Synonyms | DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2; DAD-1; oligosaccharyltransferase 2 homolog; oligosaccharyl transferase subunit DAD1; |
mRNA Refseq | NM_001344 |
Protein Refseq | NP_001335 |
MIM | 600243 |
UniProt ID | P61803 |
Gene ID | 1603 |
◆ Recombinant Proteins | ||
RFL2598SF | Recombinant Full Length Solanum Lycopersicum Defender Against Cell Death 1(Dad1) Protein, His-Tagged | +Inquiry |
DAD1-1769R | Recombinant Rat DAD1 Protein | +Inquiry |
DAD1-120HF | Recombinant Full Length Human DAD1 Protein | +Inquiry |
DAD1-11817H | Recombinant Human DAD1 protein, GST-tagged | +Inquiry |
DAD1-1739C | Recombinant Chicken DAD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAD1-215HCL | Recombinant Human DAD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAD1 Products
Required fields are marked with *
My Review for All DAD1 Products
Required fields are marked with *
0
Inquiry Basket