Recombinant Human DAPP1 Protein, GST-tagged
| Cat.No. : | DAPP1-2344H |
| Product Overview : | Human DAPP1 full-length ORF ( AAH12924, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DAPP1 (Dual Adaptor Of Phosphotyrosine And 3-Phosphoinositides 1) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I PI3K signaling events. GO annotations related to this gene include phospholipid binding and phosphatidylinositol-3,4-bisphosphate binding. |
| Molecular Mass : | 56.32 kDa |
| AA Sequence : | MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DAPP1 dual adaptor of phosphotyrosine and 3-phosphoinositides [ Homo sapiens ] |
| Official Symbol | DAPP1 |
| Synonyms | DAPP1; dual adaptor of phosphotyrosine and 3-phosphoinositides; dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; BAM32; hDAPP1; B-cell adapter molecule of 32 kDa; b lymphocyte adapter protein Bam32; DKFZp667E0716; |
| Gene ID | 27071 |
| mRNA Refseq | NM_014395 |
| Protein Refseq | NP_055210 |
| MIM | 605768 |
| UniProt ID | Q9UN19 |
| ◆ Recombinant Proteins | ||
| DAPP1-2146C | Recombinant Chicken DAPP1 | +Inquiry |
| DAPP1-11828H | Recombinant Human DAPP1, GST-tagged | +Inquiry |
| DAPP1-2512HF | Recombinant Full Length Human DAPP1 Protein, GST-tagged | +Inquiry |
| DAPP1-2344H | Recombinant Human DAPP1 Protein, GST-tagged | +Inquiry |
| DAPP1-2449Z | Recombinant Zebrafish DAPP1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DAPP1-7074HCL | Recombinant Human DAPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DAPP1 Products
Required fields are marked with *
My Review for All DAPP1 Products
Required fields are marked with *
