Recombinant Human DAW1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DAW1-3013H
Product Overview : WDR69 MS Standard C13 and N15-labeled recombinant protein (NP_849143) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : DAW1 (Dynein Assembly Factor With WD Repeats 1) is a Protein Coding gene. Diseases associated with DAW1 include Ciliary Dyskinesia, Primary, 2 and Dextro-Looped Transposition Of The Great Arteries. An important paralog of this gene is WDR88.
Molecular Mass : 45.8 kDa
AA Sequence : MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DAW1 dynein assembly factor with WD repeats 1 [ Homo sapiens (human) ]
Official Symbol DAW1
Synonyms DAW1; dynein assembly factor with WD repeats 1; ODA16; WDR69; dynein assembly factor with WDR repeat domains 1; WD repeat domain 69; WD repeat-containing protein 69; outer row dynein assembly 16 homolog; outer row dynein assembly protein 16 homolog; testis tissue sperm-binding protein Li 93mP
Gene ID 164781
mRNA Refseq NM_178821
Protein Refseq NP_849143
UniProt ID Q8N136

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAW1 Products

Required fields are marked with *

My Review for All DAW1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon