Recombinant Human DAW1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DAW1-3013H
• Product Overview: WDR69 MS Standard C13 and N15-labeled recombinant protein (NP_849143) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: DAW1 (Dynein Assembly Factor With WD Repeats 1) is a Protein Coding gene. Diseases associated with DAW1 include Ciliary Dyskinesia, Primary, 2 and Dextro-Looped Transposition Of The Great Arteries. An important paralog of this gene is WDR88.
• Molecular Mass: 45.8 kDa
• AA Sequence: MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DAW1 dynein assembly factor with WD repeats 1 [ Homo sapiens (human) ]
• Official Symbol: DAW1
• Synonyms: DAW1; dynein assembly factor with WD repeats 1; ODA16; WDR69; dynein assembly factor with WDR repeat domains 1; WD repeat domain 69; WD repeat-containing protein 69; outer row dynein assembly 16 homolog; outer row dynein assembly protein 16 homolog; testis tissue sperm-binding protein Li 93mP
• Gene ID: 164781
• mRNA Refseq: NM_178821
• Protein Refseq: NP_849143
• UniProt ID: Q8N136