Recombinant Human DBI Protein, GST-tagged
| Cat.No. : | DBI-2367H |
| Product Overview : | Human DBI full-length ORF ( NP_065438.1, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 38.2 kDa |
| AA Sequence : | MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DBI diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [ Homo sapiens ] |
| Official Symbol | DBI |
| Synonyms | DBI; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl Coenzyme A binding protein); acyl-CoA-binding protein; ACBD1; ACBP; endozepine; GABA receptor modulator; diazepam-binding inhibitor; acyl coenzyme A binding protein; acyl-Coenzyme A binding domain containing 1; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein); EP; CCK-RP; MGC70414; |
| Gene ID | 1622 |
| mRNA Refseq | NM_001079862 |
| Protein Refseq | NP_001073331 |
| MIM | 125950 |
| UniProt ID | P07108 |
| ◆ Recombinant Proteins | ||
| DBI-1232H | Recombinant Human DBI protein(Met1-Ala87), His-tagged | +Inquiry |
| DBI-3201H | Recombinant Human DBI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Dbi-2462M | Recombinant Mouse Dbi Protein, Myc/DDK-tagged | +Inquiry |
| Dbi-2800M | Recombinant Mouse Dbi protein, His&Myc-tagged | +Inquiry |
| Dbi-3133R | Recombinant Rat Dbi, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DBI-7066HCL | Recombinant Human DBI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBI Products
Required fields are marked with *
My Review for All DBI Products
Required fields are marked with *
