Recombinant Human DBI protein, GST-tagged
| Cat.No. : | DBI-301619H |
| Product Overview : | Recombinant Human DBI (1-102 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Tyr102 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | DBI diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [ Homo sapiens ] |
| Official Symbol | DBI |
| Synonyms | DBI; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl Coenzyme A binding protein); acyl-CoA-binding protein; ACBD1; ACBP; endozepine; GABA receptor modulator; diazepam-binding inhibitor; acyl coenzyme A binding protein; acyl-Coenzyme A binding domain containing 1; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein); EP; CCK-RP; MGC70414; |
| Gene ID | 1622 |
| mRNA Refseq | NM_001079862 |
| Protein Refseq | NP_001073331 |
| MIM | 125950 |
| UniProt ID | P07108 |
| ◆ Recombinant Proteins | ||
| DBI-720H | Recombinant Human DBI Protein, His (Fc)-Avi-tagged | +Inquiry |
| DBI-1232H | Recombinant Human DBI protein(Met1-Ala87), His-tagged | +Inquiry |
| DBI-1925H | Recombinant Human DBI Protein (Ala4-Ile87), N-GST tagged | +Inquiry |
| Dbi-8181M | Recombinant Mouse Dbi protein, His-tagged | +Inquiry |
| DBI-11842H | Recombinant Human DBI, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DBI-7066HCL | Recombinant Human DBI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBI Products
Required fields are marked with *
My Review for All DBI Products
Required fields are marked with *



