Recombinant Human DBNDD2 protein, GST-tagged

Cat.No. : DBNDD2-301501H
Product Overview : Recombinant Human DBNDD2 (60-161 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Asp60-Ser161
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name DBNDD2 dysbindin (dystrobrevin binding protein 1) domain containing 2 [ Homo sapiens ]
Official Symbol DBNDD2
Synonyms CK1BP; HSMNP1; C20orf35
Gene ID 55861
mRNA Refseq NM_018478.3
Protein Refseq NP_060948.3
MIM 611453
UniProt ID Q9BQY9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DBNDD2 Products

Required fields are marked with *

My Review for All DBNDD2 Products

Required fields are marked with *

0
cart-icon