Recombinant Human DBNDD2 protein, GST-tagged
Cat.No. : | DBNDD2-301501H |
Product Overview : | Recombinant Human DBNDD2 (60-161 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asp60-Ser161 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | DBNDD2 dysbindin (dystrobrevin binding protein 1) domain containing 2 [ Homo sapiens ] |
Official Symbol | DBNDD2 |
Synonyms | CK1BP; HSMNP1; C20orf35 |
Gene ID | 55861 |
mRNA Refseq | NM_018478.3 |
Protein Refseq | NP_060948.3 |
MIM | 611453 |
UniProt ID | Q9BQY9 |
◆ Recombinant Proteins | ||
Dbndd2-2464M | Recombinant Mouse Dbndd2 Protein, Myc/DDK-tagged | +Inquiry |
DBNDD2-6963H | Recombinant Human Dysbindin (dystrobrevin binding protein 1) Domain Containing 2, His-tagged | +Inquiry |
DBNDD2-5585H | Recombinant Human DBNDD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DBNDD2-4786H | Recombinant Human DBNDD2 protein, His-SUMO-tagged | +Inquiry |
DBNDD2-301501H | Recombinant Human DBNDD2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBNDD2-7064HCL | Recombinant Human DBNDD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBNDD2 Products
Required fields are marked with *
My Review for All DBNDD2 Products
Required fields are marked with *