Recombinant Human DCLRE1B Protein, GST-tagged
| Cat.No. : | DCLRE1B-5183H | 
| Product Overview : | Human DCLRE1B full-length ORF ( NP_073747.1, 1 a.a. - 532 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | DNA interstrand cross-links prevent strand separation, thereby physically blocking transcription, replication, and segregation of DNA. DCLRE1B is one of several evolutionarily conserved genes involved in repair of interstrand cross-links (Dronkert et al., 2000 [PubMed 10848582]).[supplied by OMIM, Mar 2008] | 
| Molecular Mass : | 86.4 kDa | 
| AA Sequence : | MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | DCLRE1B DNA cross-link repair 1B [ Homo sapiens (human) ] | 
| Official Symbol | DCLRE1B | 
| Synonyms | DCLRE1B; DNA cross-link repair 1B; SNM1B; SNMIB; APOLLO; 5' exonuclease Apollo; DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae); PSO2 homolog; SNM1 homolog B | 
| Gene ID | 64858 | 
| mRNA Refseq | NM_001319946 | 
| Protein Refseq | NP_001306875 | 
| MIM | 609683 | 
| UniProt ID | Q9H816 | 
| ◆ Recombinant Proteins | ||
| DCLRE1B-4657Z | Recombinant Zebrafish DCLRE1B | +Inquiry | 
| DCLRE1B-1795R | Recombinant Rat DCLRE1B Protein | +Inquiry | 
| DCLRE1B-4353M | Recombinant Mouse DCLRE1B Protein | +Inquiry | 
| DCLRE1B-3855HF | Recombinant Full Length Human DCLRE1B Protein, GST-tagged | +Inquiry | 
| DCLRE1B-5183H | Recombinant Human DCLRE1B Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DCLRE1B-7050HCL | Recombinant Human DCLRE1B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All DCLRE1B Products
Required fields are marked with *
My Review for All DCLRE1B Products
Required fields are marked with *
  
        
    
      
            