Recombinant Human DCN protein, His-tagged
Cat.No. : | DCN-6845H |
Product Overview : | Recombinant Human DCN protein(31-172 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-172 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNG |
Gene Name | DCN decorin [ Homo sapiens ] |
Official Symbol | DCN |
Synonyms | DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2; |
Gene ID | 1634 |
mRNA Refseq | NM_001920 |
Protein Refseq | NP_001911 |
MIM | 125255 |
UniProt ID | P07585 |
◆ Recombinant Proteins | ||
DCN-815H | Recombinant Human DCN Protein, His-tagged | +Inquiry |
DCN-2804H | Recombinant Human DCN protein, His-tagged | +Inquiry |
DCN-6518H | Recombinant Human DCN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DCN-6844H | Recombinant Human DCN protein, GST-tagged | +Inquiry |
DCN-450M | Recombinant Mouse DCN Protein (35-354 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *