Recombinant Human DCN protein, T7/His-tagged

Cat.No. : DCN-82H
Product Overview : Recombinant human decorin extracellular domain cDNA (31-359 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 31-359 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQG^GEFEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVP KDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKT LQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTEL HLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHN NNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Purity : >90% by SDS-PAGE
Applications : 1. May be used as coating matrix protein for human cell functional and differentiation regulation study in vitro,2. May be used as potential biomarker for lung cancer diagnostic development.3. May be used for specific antibody production.
Storage : Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name DCN decorin [ Homo sapiens ]
Official Symbol DCN
Synonyms DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2;
Gene ID 1634
mRNA Refseq NM_001920
Protein Refseq NP_001911
MIM 125255
UniProt ID P07585
Chromosome Location 12q23
Pathway TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; Validated transcriptional targets of AP1 family members Fra1 and Fra2, organism-specific biosystem;
Function collagen binding; extracellular matrix binding; glycosaminoglycan binding; protein N-terminus binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCN Products

Required fields are marked with *

My Review for All DCN Products

Required fields are marked with *

0
cart-icon
0
compare icon