Recombinant Human DCN protein, T7/His-tagged
Cat.No. : | DCN-82H |
Product Overview : | Recombinant human decorin extracellular domain cDNA (31-359 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 31-359 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQG^GEFEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVP KDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKT LQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTEL HLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHN NNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used as coating matrix protein for human cell functional and differentiation regulation study in vitro,2. May be used as potential biomarker for lung cancer diagnostic development.3. May be used for specific antibody production. |
Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | DCN decorin [ Homo sapiens ] |
Official Symbol | DCN |
Synonyms | DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2; |
Gene ID | 1634 |
mRNA Refseq | NM_001920 |
Protein Refseq | NP_001911 |
MIM | 125255 |
UniProt ID | P07585 |
Chromosome Location | 12q23 |
Pathway | TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; Validated transcriptional targets of AP1 family members Fra1 and Fra2, organism-specific biosystem; |
Function | collagen binding; extracellular matrix binding; glycosaminoglycan binding; protein N-terminus binding; |
◆ Recombinant Proteins | ||
DCN-5390B | Recombinant Bovine DCN protein, His-tagged | +Inquiry |
DCN-73H | Recombinant Human DCN protein(Asp31-Lys359), hFc-tagged | +Inquiry |
DCN-371S | Recombinant Sheep DCN protein, His-tagged | +Inquiry |
DCN-815H | Recombinant Human DCN Protein, His-tagged | +Inquiry |
DCN-2398H | Recombinant Human DCN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *
0
Inquiry Basket