Recombinant Human DCP1A Protein, GST-tagged
| Cat.No. : | DCP1A-2399H |
| Product Overview : | Human DCP1A full-length ORF ( AAH07439.1, 1 a.a. - 582 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
| Molecular Mass : | 89.7 kDa |
| AA Sequence : | MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCP1A DCP1 decapping enzyme homolog A (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DCP1A |
| Synonyms | DCP1A; DCP1 decapping enzyme homolog A (S. cerevisiae); mRNA-decapping enzyme 1A; HSA275986; SMAD4IP1; SMIF; decapping enzyme hDcp1a; transcription factor SMIF; putative protein product of Nbla00360; Smad4-interacting transcriptional co-activator; Nbla00360; FLJ21691; |
| Gene ID | 55802 |
| mRNA Refseq | NM_018403 |
| Protein Refseq | NP_060873 |
| MIM | 607010 |
| UniProt ID | Q9NPI6 |
| ◆ Recombinant Proteins | ||
| DCP1A-2888HF | Recombinant Full Length Human DCP1A Protein, GST-tagged | +Inquiry |
| DCP1A-4904H | Recombinant Human DCP1A protein, His-tagged | +Inquiry |
| DCP1A-2399H | Recombinant Human DCP1A Protein, GST-tagged | +Inquiry |
| Dcp1a-2476M | Recombinant Mouse Dcp1a Protein, Myc/DDK-tagged | +Inquiry |
| DCP1A-2236M | Recombinant Mouse DCP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCP1A-7048HCL | Recombinant Human DCP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCP1A Products
Required fields are marked with *
My Review for All DCP1A Products
Required fields are marked with *
