Recombinant Human DCUN1D1 Protein, GST-tagged
Cat.No. : | DCUN1D1-2418H |
Product Overview : | Human DCUN1D1 full-length ORF ( NP_065691.2, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DCUN1D1 (Defective In Cullin Neddylation 1 Domain Containing 1) is a Protein Coding gene. Diseases associated with DCUN1D1 include Squamous Cell Carcinoma Of The Oral Tongue and Squamous Cell Carcinoma. An important paralog of this gene is DCUN1D2. |
Molecular Mass : | 56.5 kDa |
AA Sequence : | MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCUN1D1 DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DCUN1D1 |
Synonyms | DCUN1D1; DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae); DCN1-like protein 1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; RP42 homolog; DCUN1 domain-containing protein 1; squamous cell carcinoma-related oncogene; defective in cullin neddylation protein 1-like protein 1; DCNL1; |
Gene ID | 54165 |
mRNA Refseq | NM_020640 |
Protein Refseq | NP_065691 |
MIM | 605905 |
UniProt ID | Q96GG9 |
◆ Recombinant Proteins | ||
DCUN1D1-1199R | Recombinant Rhesus monkey DCUN1D1 Protein, His-tagged | +Inquiry |
DCUN1D1-3430H | Recombinant Human DCUN1D1 protein, His-tagged | +Inquiry |
Dcun1d1-537M | Recombinant Mouse Dcun1d1 Protein, MYC/DDK-tagged | +Inquiry |
DCUN1D1-510H | Recombinant Human DCUN1D1 Protein, His-tagged | +Inquiry |
DCUN1D1-10161Z | Recombinant Zebrafish DCUN1D1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCUN1D1-7035HCL | Recombinant Human DCUN1D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCUN1D1 Products
Required fields are marked with *
My Review for All DCUN1D1 Products
Required fields are marked with *
0
Inquiry Basket